PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009123747.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Trihelix
Protein Properties Length: 622aa    MW: 69374.5 Da    PI: 5.8534
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009123747.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix97.21.4e-3053137187
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                     rW+++e+laL+++r+em++++r++ lk+plWe+vs+k+ e g++rs+k+Ckek+en++k+yk++ke++++r++++   +++f+qlea
  XP_009123747.1  53 RWPREETLALLRIRSEMDSTFRDATLKAPLWEHVSRKLLELGYKRSAKKCKEKFENVQKYYKRTKETRGGRHDGK--AYKFFSQLEA 137
                     8*********************************************************************86555..5******985 PP

2trihelix104.11e-32388472186
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     rW+k e+laLi++r+ me r++++  k+ lWee+s+ m++ g++r++k+Ckekwen+nk+ykk+ke++k+r +++ +tcpyf++l+
  XP_009123747.1 388 RWPKAEILALINLRSGMEPRYQDNVPKGLLWEEISSSMKRMGYNRNAKRCKEKWENINKYYKKVKESNKER-PQDAKTCPYFHRLD 472
                     8*********************************************************************8.99999*******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.10846110IPR017877Myb-like domain
SMARTSM007170.003150112IPR001005SANT/Myb domain
PfamPF138379.2E-2152138No hitNo description
CDDcd122039.04E-2852117No hitNo description
PROSITE profilePS500906.922381445IPR017877Myb-like domain
SMARTSM007170.0045385447IPR001005SANT/Myb domain
PfamPF138377.3E-22387472No hitNo description
CDDcd122031.64E-30388452No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:0010090Biological Processtrichome morphogenesis
GO:0030308Biological Processnegative regulation of cell growth
GO:0032876Biological Processnegative regulation of DNA endoreduplication
GO:0042631Biological Processcellular response to water deprivation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:2000037Biological Processregulation of stomatal complex patterning
GO:2000038Biological Processregulation of stomatal complex development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 622 aa     Download sequence    Send to blast
MEQGAGGGNE VVEEASPISS RPPANMEELM RFSAAADDGG GLGGSSSSSS GNRWPREETL  60
ALLRIRSEMD STFRDATLKA PLWEHVSRKL LELGYKRSAK KCKEKFENVQ KYYKRTKETR  120
GGRHDGKAYK FFSQLEALNT TPPSSSLDAT PLSVANPIQP PPSSSHFPVF PLPQTQPHTV  180
SFTPNVPPPP PPMGPTFPGA TFSSHSSSTA SGMGSDDEDI MDVDQAGPSS RKRKRGNRGG  240
GKMMELFDGL VRQVMQKQAA MQRSFLEALE KREQERLHRE EAWKRQEMSR LAREHEIMSQ  300
ERAASASRDA AIISLIQKIT GHTIQLPPSF SSQPSPPPPP AAKRPSSQPP QLQPIMAIPQ  360
QQVLPPPPPQ PQQEVIMSSD QSSPSSSRWP KAEILALINL RSGMEPRYQD NVPKGLLWEE  420
ISSSMKRMGY NRNAKRCKEK WENINKYYKK VKESNKERPQ DAKTCPYFHR LDLLYRNKVL  480
GTGGSSSASA LPHQDQISTV QKQSPVSAVK PPQGVVTVGS ASSEEEEPRE ESPQGTEKPE  540
DLVMKELMQH QQQDSMISEY EKIEESHNYN NMEEEEEEEE EEEMDEELDE DEKSAAYEVA  600
FQSPANRGGN GHTEPPFLTM VQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
195103KRSAKKCKE
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00177DAPTransfer from AT1G33240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0210451e-117AC021045.2 Arabidopsis thaliana chromosome I BAC T9L6 genomic sequence, complete sequence.
GenBankAC0270351e-117AC027035.5 Arabidopsis thaliana chromosome 1 BAC T16O9 genomic sequence, complete sequence.
GenBankAJ0032151e-117AJ003215.1 Arabidopsis thaliana GTL1 gene.
GenBankAY1400851e-117AY140085.1 Arabidopsis thaliana DNA-binding factor, putative (At1g33240) mRNA, complete cds.
GenBankBT0088241e-117BT008824.1 Arabidopsis thaliana At1g33240 mRNA, complete cds.
GenBankCP0026841e-117CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009123747.10.0PREDICTED: trihelix transcription factor GTL1 isoform X1
RefseqXP_013717446.10.0PREDICTED: trihelix transcription factor GTL1-like isoform X1
SwissprotQ9C8820.0GTL1_ARATH; Trihelix transcription factor GTL1
TrEMBLM4FFY60.0M4FFY6_BRARP; Uncharacterized protein
STRINGBra040010.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM62262746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33240.11e-104GT-2-like 1